Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins) the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology |
Protein Pyruvate oxidase [88729] (2 species) |
Species Aerococcus viridans [TaxId:1377] [142203] (4 PDB entries) |
Domain d1v5fa2: 1v5f A:4-186 [119848] Other proteins in same PDB: d1v5fa1, d1v5fa3 automatically matched to 1V5E A:3-186 complexed with fad, mg, so4, tpp |
PDB Entry: 1v5f (more details), 1.8 Å
SCOPe Domain Sequences for d1v5fa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v5fa2 c.36.1.5 (A:4-186) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} nkiniglavmkileswgadtiygipsgtlsslmdamgeeennvkflqvkheevgamaavm qskfggnlgvtvgsggpgashlinglydaamdnipvvailgsrpqrelnmdafqelnqnp mydhiavynrrvayaeqlpklvdeaarmaiakrgvavlevpgdfakveidndqwyssans lrk
Timeline for d1v5fa2: