Lineage for d1v5fa2 (1v5f A:4-186)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 694610Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 694611Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 694612Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology
  6. 694711Protein Pyruvate oxidase [88729] (2 species)
  7. 694712Species Aerococcus viridans [TaxId:1377] [142203] (4 PDB entries)
  8. 694715Domain d1v5fa2: 1v5f A:4-186 [119848]
    Other proteins in same PDB: d1v5fa1, d1v5fa3
    automatically matched to 1V5E A:3-186
    complexed with fad, mg, so4, tpp

Details for d1v5fa2

PDB Entry: 1v5f (more details), 1.8 Å

PDB Description: Crystal Structure of Pyruvate oxidase complexed with FAD and TPP, from Aerococcus viridans
PDB Compounds: (A:) Pyruvate oxidase

SCOP Domain Sequences for d1v5fa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v5fa2 c.36.1.5 (A:4-186) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]}
nkiniglavmkileswgadtiygipsgtlsslmdamgeeennvkflqvkheevgamaavm
qskfggnlgvtvgsggpgashlinglydaamdnipvvailgsrpqrelnmdafqelnqnp
mydhiavynrrvayaeqlpklvdeaarmaiakrgvavlevpgdfakveidndqwyssans
lrk

SCOP Domain Coordinates for d1v5fa2:

Click to download the PDB-style file with coordinates for d1v5fa2.
(The format of our PDB-style files is described here.)

Timeline for d1v5fa2: