SCOPe 2.08: Domain d1v5fa2: 1v5f A:4-177

Lineage for d1v5fa2 (1v5f A:4-177)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.0: automated matches [227300] (1 protein)
   not a true family

6. Protein automated matches [227126] (21 species)
   not a true protein

7. Species Aerococcus viridans [TaxId:1377] [254913] (2 PDB entries)

8. Domain d1v5fa2: 1v5f A:4-177 [119848]
   Other proteins in same PDB: d1v5fa1
   automated match to d1poxa2
   complexed with fad, mg, so4, tpp

Details for d1v5fa2

PDB Entry: 1v5f, 1.8 Å

PDB Description: Crystal Structure of Pyruvate oxidase complexed with FAD and TPP, from Aerococcus viridans

PDB Compounds: (A:) Pyruvate oxidase

SCOPe Domain Sequences for d1v5fa2:

Sequence; same for both SEQRES and ATOM records:

>d1v5fa2 c.36.1.0 (A:4-177) automated matches {Aerococcus viridans [TaxId: 1377]}
nkiniglavmkileswgadtiygipsgtlsslmdamgeeennvkflqvkheevgamaavm
qskfggnlgvtvgsggpgashlinglydaamdnipvvailgsrpqrelnmdafqelnqnp
mydhiavynrrvayaeqlpklvdeaarmaiakrgvavlevpgdfakveidndqw

Timeline for d1v5fa2:

• d1v5fa2 first appeared in SCOP 1.73
  
• d1v5fa2 appears in SCOPe 2.07