Lineage for d1v5fa1 (1v5f A:187-363)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1360793Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 1360794Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 1360823Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins)
    N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold
  6. 1360949Protein Pyruvate oxidase [52476] (2 species)
    binds FAD
  7. 1360950Species Aerococcus viridans [TaxId:1377] [142122] (4 PDB entries)
  8. 1360952Domain d1v5fa1: 1v5f A:187-363 [119847]
    Other proteins in same PDB: d1v5fa2, d1v5fa3
    automatically matched to 1V5E A:187-363
    complexed with fad, mg, so4, tpp

Details for d1v5fa1

PDB Entry: 1v5f (more details), 1.8 Å

PDB Description: Crystal Structure of Pyruvate oxidase complexed with FAD and TPP, from Aerococcus viridans
PDB Compounds: (A:) Pyruvate oxidase

SCOPe Domain Sequences for d1v5fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v5fa1 c.31.1.3 (A:187-363) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]}
yapiapaaqdidaavellnnskrpviyagigtmghgpavqelarkikapvittgknfetf
ewdfealtgstyrvgwkpanetileadtvlfagsnfpfsevegtfrnvdnfiqididpam
lgkrhhadvailgdaalaideilnkvdaveesawwtanlknianwreyinmletkee

SCOPe Domain Coordinates for d1v5fa1:

Click to download the PDB-style file with coordinates for d1v5fa1.
(The format of our PDB-style files is described here.)

Timeline for d1v5fa1: