Lineage for d1v5ea3 (1v5e A:364-592)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122269Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2122270Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2122564Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology
  6. 2122692Protein Pyruvate oxidase [88754] (2 species)
  7. 2122693Species Aerococcus viridans [TaxId:1377] [142207] (2 PDB entries)
  8. 2122695Domain d1v5ea3: 1v5e A:364-592 [119846]
    Other proteins in same PDB: d1v5ea1, d1v5ea2
    complexed with fad, so4

Details for d1v5ea3

PDB Entry: 1v5e (more details), 1.6 Å

PDB Description: Crystal Structure of Pyruvate oxidase containing FAD, from Aerococcus viridans
PDB Compounds: (A:) Pyruvate oxidase

SCOPe Domain Sequences for d1v5ea3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v5ea3 c.36.1.9 (A:364-592) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]}
gdlqfyqvynainnhadedaiysidvgnstqtsirhlhmtpknmwrtsplfatmgiaipg
glgakntypdrqvwniigdgafsmtypdvvtnvrynmpvinvvfsnteyafiknkyedtn
knlfgvdftdvdyakiaeaqgakgftvsriedmdrvmaeavaankaghtvvidckitqdr
pipvetlkldsklysedeikaykeryeaanlvpfreyleaegleskyik

SCOPe Domain Coordinates for d1v5ea3:

Click to download the PDB-style file with coordinates for d1v5ea3.
(The format of our PDB-style files is described here.)

Timeline for d1v5ea3: