Lineage for d1v5ea1 (1v5e A:187-363)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2121033Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2121034Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2121061Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins)
    N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold
  6. 2121257Protein Pyruvate oxidase [52476] (2 species)
    binds FAD
  7. 2121258Species Aerococcus viridans [TaxId:1377] [142122] (2 PDB entries)
  8. 2121260Domain d1v5ea1: 1v5e A:187-363 [119844]
    Other proteins in same PDB: d1v5ea2, d1v5ea3
    complexed with fad, so4

Details for d1v5ea1

PDB Entry: 1v5e (more details), 1.6 Å

PDB Description: Crystal Structure of Pyruvate oxidase containing FAD, from Aerococcus viridans
PDB Compounds: (A:) Pyruvate oxidase

SCOPe Domain Sequences for d1v5ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v5ea1 c.31.1.3 (A:187-363) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]}
yapiapaaqdidaavellnnskrpviyagigtmghgpavqelarkikapvittgknfetf
ewdfealtgstyrvgwkpanetileadtvlfagsnfpfsevegtfrnvdnfiqididpam
lgkrhhadvailgdaalaideilnkvdaveesawwtanlknianwreyinmletkee

SCOPe Domain Coordinates for d1v5ea1:

Click to download the PDB-style file with coordinates for d1v5ea1.
(The format of our PDB-style files is described here.)

Timeline for d1v5ea1: