![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) core: beta(3,4)-alpha(3); alpha+beta sandwich |
![]() | Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) ![]() both first two domains are of same beta/beta/alpha fold |
![]() | Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins) |
![]() | Protein Dihydrolipoamide dehydrogenase [55436] (8 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64331] (2 PDB entries) |
![]() | Domain d1v59b3: 1v59 B:356-478 [119843] Other proteins in same PDB: d1v59a1, d1v59a2, d1v59b1, d1v59b2 automated match to d1jeha3 complexed with fad, nad, po4 |
PDB Entry: 1v59 (more details), 2.2 Å
SCOPe Domain Sequences for d1v59b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v59b3 d.87.1.1 (B:356-478) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ynnipsvmyshpevawvgkteeqlkeagidykigkfpfaansraktnqdtegfvkilids kterilgahiigpnagemiaeaglaleygasaedvarvchahptlseafkeanmaaydka ihc
Timeline for d1v59b3: