Lineage for d1v59b3 (1v59 B:356-478)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
    both first two domains are of same beta/beta/alpha fold
  5. Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)
  6. Protein Dihydrolipoamide dehydrogenase [55436] (8 species)
  7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64331] (2 PDB entries)
  8. Domain d1v59b3: 1v59 B:356-478 [119843]
    Other proteins in same PDB: d1v59a1, d1v59a2, d1v59b1, d1v59b2
    automated match to d1jeha3
    complexed with fad, nad, po4

Details for d1v59b3

PDB Entry: 1v59 (more details), 2.2 Å

PDB Description: Crystal structure of yeast lipoamide dehydrogenase complexed with NAD+
PDB Compounds: (B:) dihydrolipoamide dehydrogenase

SCOPe Domain Sequences for d1v59b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v59b3 d.87.1.1 (B:356-478) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ynnipsvmyshpevawvgkteeqlkeagidykigkfpfaansraktnqdtegfvkilids
kterilgahiigpnagemiaeaglaleygasaedvarvchahptlseafkeanmaaydka
ihc

SCOPe Domain Coordinates for d1v59b3 are not available.

Timeline for d1v59b3:

Domains from same chain:
(mouse over for more information)
d1v59b1, d1v59b2
Domains from other chains:
(mouse over for more information)
d1v59a1, d1v59a2, d1v59a3