![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
![]() | Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) ![]() |
![]() | Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins) duplication: both domains have similar folds and functions most members of the family contain common C-terminal alpha+beta domain |
![]() | Protein Dihydrolipoamide dehydrogenase, N- and C-terminal domain [418938] (8 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [419382] (2 PDB entries) |
![]() | Domain d1v59b1: 1v59 B:1-160,B:283-355 [119841] Other proteins in same PDB: d1v59a2, d1v59a3, d1v59b2, d1v59b3 automated match to d1jeha1 complexed with fad, nad, po4 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1v59 (more details), 2.2 Å
SCOPe Domain Sequences for d1v59b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v59b1 c.3.1.5 (B:1-160,B:283-355) Dihydrolipoamide dehydrogenase, N- and C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} tinkshdvviigggpagyvaaikaaqlgfntacvekrgklggtclnvgcipskallnnsh lfhqmhteaqkrgidvngdikinvanfqkakddavkqltggiellfkknkvtyykgngsf edetkirvtpvdglegtvkedhildvkniivatgsevtpfXvgrrpyiaglgaekiglev dkrgrlviddqfnskfphikvvgdvtfgpmlahkaeeegiaavemlktghghvn
Timeline for d1v59b1: