SCOPe 2.08: Domain d1v59b1: 1v59 B:1-160,B:283-355

Lineage for d1v59b1 (1v59 B:1-160,B:283-355)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families)

5. Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins)
   duplication: both domains have similar folds and functions
   most members of the family contain common C-terminal alpha+beta domain

6. Protein Dihydrolipoamide dehydrogenase, N- and C-terminal domain [418938] (8 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [419382] (2 PDB entries)

8. Domain d1v59b1: 1v59 B:1-160,B:283-355 [119841]
   Other proteins in same PDB: d1v59a2, d1v59a3, d1v59b2, d1v59b3
   automated match to d1jeha1
   complexed with fad, nad, po4
   has additional insertions and/or extensions that are not grouped together

Details for d1v59b1

PDB Entry: 1v59, 2.2 Å

PDB Description: Crystal structure of yeast lipoamide dehydrogenase complexed with NAD+

PDB Compounds: (B:) dihydrolipoamide dehydrogenase

SCOPe Domain Sequences for d1v59b1:

Sequence; same for both SEQRES and ATOM records:

>d1v59b1 c.3.1.5 (B:1-160,B:283-355) Dihydrolipoamide dehydrogenase, N- and C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tinkshdvviigggpagyvaaikaaqlgfntacvekrgklggtclnvgcipskallnnsh
lfhqmhteaqkrgidvngdikinvanfqkakddavkqltggiellfkknkvtyykgngsf
edetkirvtpvdglegtvkedhildvkniivatgsevtpfXvgrrpyiaglgaekiglev
dkrgrlviddqfnskfphikvvgdvtfgpmlahkaeeegiaavemlktghghvn

Timeline for d1v59b1:

• d1v59b1 first appeared in SCOP 1.73
  
• d1v59b1 appears in SCOPe 2.07