Lineage for d1v59a3 (1v59 A:356-478)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1916781Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 1916782Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
    both first two domains are of same beta/beta/alpha fold
  5. 1916783Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)
  6. 1916791Protein Dihydrolipoamide dehydrogenase [55436] (8 species)
  7. 1916798Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64331] (2 PDB entries)
  8. 1916799Domain d1v59a3: 1v59 A:356-478 [119840]
    Other proteins in same PDB: d1v59a1, d1v59a2, d1v59b1, d1v59b2
    automated match to d1jeha3
    complexed with fad, nad, po4

Details for d1v59a3

PDB Entry: 1v59 (more details), 2.2 Å

PDB Description: Crystal structure of yeast lipoamide dehydrogenase complexed with NAD+
PDB Compounds: (A:) dihydrolipoamide dehydrogenase

SCOPe Domain Sequences for d1v59a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v59a3 d.87.1.1 (A:356-478) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ynnipsvmyshpevawvgkteeqlkeagidykigkfpfaansraktnqdtegfvkilids
kterilgahiigpnagemiaeaglaleygasaedvarvchahptlseafkeanmaaydka
ihc

SCOPe Domain Coordinates for d1v59a3:

Click to download the PDB-style file with coordinates for d1v59a3.
(The format of our PDB-style files is described here.)

Timeline for d1v59a3: