Lineage for d1v53a1 (1v53 A:1-356)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 708456Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 708457Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (5 families) (S)
    the constituent families form similar dimers
  5. 708458Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (3 proteins)
    the active site is between the two identical subunits
  6. 708459Protein 3-isopropylmalate dehydrogenase, IPMDH [53661] (9 species)
  7. 708460Species Bacillus coagulans [TaxId:1398] [53664] (2 PDB entries)
  8. 708463Domain d1v53a1: 1v53 A:1-356 [119836]
    automatically matched to d2ayqb_

Details for d1v53a1

PDB Entry: 1v53 (more details), 2.85 Å

PDB Description: The crystal structure of 3-isopropylmalate dehydrogenase from Bacillus coagulans
PDB Compounds: (A:) 3-isopropylmalate dehydrogenase

SCOP Domain Sequences for d1v53a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v53a1 c.77.1.1 (A:1-356) 3-isopropylmalate dehydrogenase, IPMDH {Bacillus coagulans [TaxId: 1398]}
mkmklavlpgdgigpevmdaairvlktvldndgheavfenaliggaaideagtplpeetl
dicrrsdaillgavggpkwdhnpaslrpekgllglrkemglfanlrpvkayatllnaspl
krervenvdlvivreltgglyfgrpserrgpgenevvdtlaytreeieriiekafqlaqi
rrkklasvdkanvlessrmwreiaeetakkypdvelshmlvdstsmqlianpgqfdvivt
enmfgdilsdeasvitgslgmlpsaslrsdrfgmyepvhgsapdiagqgkanplgtvlsa
almlrysfglekeaaaiekavddvlqdgyctgdlqvangkvvstieltdrliekln

SCOP Domain Coordinates for d1v53a1:

Click to download the PDB-style file with coordinates for d1v53a1.
(The format of our PDB-style files is described here.)

Timeline for d1v53a1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1v53b1