Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families) contains a small beta-sheet (wing) |
Family a.4.5.6: GntR-like transcriptional regulators [46804] (4 proteins) |
Protein Transcriptional repressor TraR, N-terminal domain [140257] (1 species) |
Species Streptomyces sp. [TaxId:1931] [140258] (1 PDB entry) Uniprot Q54677 1-99 78% identity to the UniProt entry species |
Domain d1v4ra1: 1v4r A:1-100 [119835] |
PDB Entry: 1v4r (more details)
SCOP Domain Sequences for d1v4ra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v4ra1 a.4.5.6 (A:1-100) Transcriptional repressor TraR, N-terminal domain {Streptomyces sp. [TaxId: 1931]} mpykapegkgyadvathfrtliksgelapgdtlpsvadiraqfgvaaktvsralavlkse glvssrgalgtvveknpivitgadrlkrmekngmryapge
Timeline for d1v4ra1: