SCOP 1.75: Domain d1v4ra1: 1v4r A:1-100

Lineage for d1v4ra1 (1v4r A:1-100)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.6: GntR-like transcriptional regulators [46804] (4 proteins)

6. Protein Transcriptional repressor TraR, N-terminal domain [140257] (1 species)

7. Species Streptomyces sp. [TaxId:1931] [140258] (1 PDB entry)
   Uniprot Q54677 1-99
   78% identity to the UniProt entry species

8. Domain d1v4ra1: 1v4r A:1-100 [119835]

Details for d1v4ra1

PDB Entry: 1v4r

PDB Description: solution structure of streptmycal repressor trar

PDB Compounds: (A:) Transcriptional Repressor

SCOP Domain Sequences for d1v4ra1:

Sequence; same for both SEQRES and ATOM records:

>d1v4ra1 a.4.5.6 (A:1-100) Transcriptional repressor TraR, N-terminal domain {Streptomyces sp. [TaxId: 1931]}
mpykapegkgyadvathfrtliksgelapgdtlpsvadiraqfgvaaktvsralavlkse
glvssrgalgtvveknpivitgadrlkrmekngmryapge

Timeline for d1v4ra1:

• d1v4ra1 first appeared in SCOP 1.73
  
• d1v4ra1 appears in SCOPe 2.01
  
• d1v4ra1 appears in the current release, SCOPe 2.08