Lineage for d1v4ra1 (1v4r A:1-100)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693164Family a.4.5.6: GntR-like transcriptional regulators [46804] (4 proteins)
  6. 2693183Protein Transcriptional repressor TraR, N-terminal domain [140257] (1 species)
  7. 2693184Species Streptomyces sp. [TaxId:1931] [140258] (1 PDB entry)
    Uniprot Q54677 1-99
    78% identity to the UniProt entry species
  8. 2693185Domain d1v4ra1: 1v4r A:1-100 [119835]

Details for d1v4ra1

PDB Entry: 1v4r (more details)

PDB Description: solution structure of streptmycal repressor trar
PDB Compounds: (A:) Transcriptional Repressor

SCOPe Domain Sequences for d1v4ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v4ra1 a.4.5.6 (A:1-100) Transcriptional repressor TraR, N-terminal domain {Streptomyces sp. [TaxId: 1931]}
mpykapegkgyadvathfrtliksgelapgdtlpsvadiraqfgvaaktvsralavlkse
glvssrgalgtvveknpivitgadrlkrmekngmryapge

SCOPe Domain Coordinates for d1v4ra1:

Click to download the PDB-style file with coordinates for d1v4ra1.
(The format of our PDB-style files is described here.)

Timeline for d1v4ra1: