Lineage for d1v4ba1 (1v4b A:1-200)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691580Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 691939Superfamily c.23.5: Flavoproteins [52218] (8 families) (S)
  5. 692068Family c.23.5.3: Quinone reductase [52235] (3 proteins)
    binds FAD
  6. 692069Protein ACP phosphodiesterase AcpD [110470] (2 species)
    evolved new enzymatic activity
  7. 692070Species Escherichia coli [TaxId:562] [110471] (3 PDB entries)
  8. 692071Domain d1v4ba1: 1v4b A:1-200 [119834]
    automatically matched to d1tika_
    complexed with edo, fmn, ipa

Details for d1v4ba1

PDB Entry: 1v4b (more details), 1.8 Å

PDB Description: The crystal structure of AzoR (Azo Reductase) from Escherichia coli: Oxidized form
PDB Compounds: (A:) NADH-azoreductase, FMN-dependent

SCOP Domain Sequences for d1v4ba1:

Sequence, based on SEQRES records: (download)

>d1v4ba1 c.23.5.3 (A:1-200) ACP phosphodiesterase AcpD {Escherichia coli [TaxId: 562]}
skvlvlkssilagysqsnqlsdyfveqwrekhsadeitvrdlaanpipvldgelvgalrp
sdapltprqqealalsdeliaelkahdviviaapmynfnistqlknyfdlvaragvtfry
tengpeglvtgkkaivitsrggihkdgptdlvtpylstflgfigitdvkfvfaegiaygp
emaakaqsdakaaidsivsa

Sequence, based on observed residues (ATOM records): (download)

>d1v4ba1 c.23.5.3 (A:1-200) ACP phosphodiesterase AcpD {Escherichia coli [TaxId: 562]}
skvlvlkssilagysqsnqlsdyfveqwrekhsadeitvrdlaanpipvldgelvgalra
pltprqqealalsdeliaelkahdviviaapmynfnistqlknyfdlvaragvtfryten
gpeglvtgkkaivitsrggihkdgptdlvtpylstflgfigitdvkfvfaegiaygpema
akaqsdakaaidsivsa

SCOP Domain Coordinates for d1v4ba1:

Click to download the PDB-style file with coordinates for d1v4ba1.
(The format of our PDB-style files is described here.)

Timeline for d1v4ba1: