Class b: All beta proteins [48724] (174 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (6 families) peptide-binding domain |
Family b.36.1.1: PDZ domain [50157] (46 proteins) Pfam PF00595 |
Protein Syntenin 1 [89311] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [89312] (11 PDB entries) |
Domain d1v1tb2: 1v1t B:197-272 [119833] automatically matched to d1ntea_ complexed with bez |
PDB Entry: 1v1t (more details), 1.8 Å
SCOP Domain Sequences for d1v1tb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v1tb2 b.36.1.1 (B:197-272) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} rtitmhkdstghvgfifkngkitsivkdssaarnglltehniceingqnviglkdsqiad ilstsgtvvtitimpa
Timeline for d1v1tb2: