Lineage for d1v1je1 (1v1j E:1-150)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691580Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 692549Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (1 family) (S)
  5. 692550Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (1 protein)
  6. 692551Protein Type II 3-dehydroquinate dehydratase [52306] (5 species)
  7. 692610Species Streptomyces coelicolor [TaxId:1902] [52308] (7 PDB entries)
  8. 692675Domain d1v1je1: 1v1j E:1-150 [119822]
    automatically matched to d1d0ih_
    complexed with fa3, trs

Details for d1v1je1

PDB Entry: 1v1j (more details), 2.2 Å

PDB Description: crystal structure of type ii dehydroquintae dehydratase from streptomyces coelicolor in complex with 3-fluoro
PDB Compounds: (E:) 3-dehydroquinate dehydratase

SCOP Domain Sequences for d1v1je1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v1je1 c.23.13.1 (E:1-150) Type II 3-dehydroquinate dehydratase {Streptomyces coelicolor [TaxId: 1902]}
prslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnheg
elvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhs
yvsqradgvvagcgvqgyvfgveriaalag

SCOP Domain Coordinates for d1v1je1:

Click to download the PDB-style file with coordinates for d1v1je1.
(The format of our PDB-style files is described here.)

Timeline for d1v1je1: