Lineage for d1v18a_ (1v18 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006338Family a.118.1.1: Armadillo repeat [48372] (7 protein domains)
  6. 2006450Protein automated matches [190070] (3 species)
    not a true protein
  7. 2006475Species Mouse (Mus musculus) [TaxId:10090] [186790] (4 PDB entries)
  8. 2006476Domain d1v18a_: 1v18 A: [119816]
    automated match to d1g3ja_

Details for d1v18a_

PDB Entry: 1v18 (more details), 2.1 Å

PDB Description: the crystal structure of beta-catenin armadillo repeat complexed with a phosphorylated apc 20mer repeat.
PDB Compounds: (A:) beta-catenin

SCOPe Domain Sequences for d1v18a_:

Sequence, based on SEQRES records: (download)

>d1v18a_ a.118.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
traipeltkllndedqvvvnkaavmvhqlskkeasrhaimrspqmvsaivrtmqntndve
tarctagtlhnlshhregllaifksggipalvkmlgspvdsvlfyaittlhnlllhqega
kmavrlagglqkmvallnktnvkflaittdclqilaygnqeskliilasggpqalvnimr
tytyekllwttsrvlkvlsvcssnkpaiveaggmqalglhltdpsqrlvqnclwtlrnls
daatkqegmegllgtlvqllgsddinvvtcaagilsnltcnnyknkmmvcqvggiealvr
tvlragdreditepaicalrhltsrhqeaemaqnavrlhyglpvvvkllhppshwplika
tvglirnlalcpanhaplreqgaiprlvqllvrahqdtqrrtsmggtqqqfvegvrmeei
vegctgalhilardvhnrivirglntiplfvqllyspieniqrvaagvlcelaqdkeaae
aieaegatapltellhsrnegvatyaaavlfrmsed

Sequence, based on observed residues (ATOM records): (download)

>d1v18a_ a.118.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
traipeltkllndedqvvvnkaavmvhqlskkeasrhaimrspqmvsaivrtmqntndve
tarctagtlhnlshhregllaifksggipalvkmlgspvdsvlfyaittlhnlllhqega
kmavrlagglqkmvallnktnvkflaittdclqilaygnqeskliilasggpqalvnimr
tytyekllwttsrvlkvlsvcssnkpaiveaggmqalglhltdpsqrlvqnclwtlrnls
daatkqegmegllgtlvqllgsddinvvtcaagilsnltcnnyknkmmvcqvggiealvr
tvlragdreditepaicalrhltsrhqeaemaqnavrlhyglpvvvkllhppshwplika
tvglirnlalcpanhaplreqgaiprlvqllvrahqdtqrrqfvegvrmeeivegctgal
hilardvhnrivirglntiplfvqllyspieniqrvaagvlcelaqdkeaaeaieaegat
apltellhsrnegvatyaaavlfrmsed

SCOPe Domain Coordinates for d1v18a_:

Click to download the PDB-style file with coordinates for d1v18a_.
(The format of our PDB-style files is described here.)

Timeline for d1v18a_: