Lineage for d1v0aa1 (1v0a A:4-170)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1304969Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1304970Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) (S)
  5. 1305620Family b.18.1.30: CBM11 [141116] (1 protein)
    Pfam PF03425; Carbohydrate binding domain (family 11)
  6. 1305621Protein Endoglucanase H [141117] (1 species)
  7. 1305622Species Clostridium thermocellum [TaxId:1515] [141118] (1 PDB entry)
    Uniprot P16218 655-821
  8. 1305623Domain d1v0aa1: 1v0a A:4-170 [119815]
    complexed with ca, so4

Details for d1v0aa1

PDB Entry: 1v0a (more details), 1.98 Å

PDB Description: family 11 carbohydrate-binding module of cellulosomal cellulase lic26a-cel5e of clostridium thermocellum
PDB Compounds: (A:) endoglucanase h

SCOPe Domain Sequences for d1v0aa1:

Sequence, based on SEQRES records: (download)

>d1v0aa1 b.18.1.30 (A:4-170) Endoglucanase H {Clostridium thermocellum [TaxId: 1515]}
avgekmlddfegvlnwgsysgegakvstkivsgktgngmevsytgttdgywgtvyslpdg
dwskwlkisfdiksvdgsaneirfmiaeksingvgdgehwvysitpdsswktieipfssf
rrrldyqppgqdmsgtldldnidsihfmyannksgkfvvdnikliga

Sequence, based on observed residues (ATOM records): (download)

>d1v0aa1 b.18.1.30 (A:4-170) Endoglucanase H {Clostridium thermocellum [TaxId: 1515]}
avgekmlddfegvlnwgsysgegakvstkivsgktgngmevsytgttdgywgtvyslpdg
dwskwlkisfdiksvaneirfmiaeksingvgdgehwvysitpdsswktieipfssfrrr
ldyqppgqdmsgtldldnidsihfmyannksgkfvvdnikliga

SCOPe Domain Coordinates for d1v0aa1:

Click to download the PDB-style file with coordinates for d1v0aa1.
(The format of our PDB-style files is described here.)

Timeline for d1v0aa1: