Lineage for d1uzna_ (1uzn A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2847786Species Mycobacterium tuberculosis [TaxId:83332] [186789] (19 PDB entries)
  8. 2847790Domain d1uzna_: 1uzn A: [119813]
    automated match to d1q7ba_
    complexed with cs, nap

Details for d1uzna_

PDB Entry: 1uzn (more details), 1.91 Å

PDB Description: maba from mycobacterium tuberculosis
PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier protein] reductase

SCOPe Domain Sequences for d1uzna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uzna_ c.2.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
akppfvsrsvlvtggnrgiglaiaqrlaadghkvavthrgsgapkglfgvevdvtdsdav
draftaveehqgpvevlvsnaglsadaflmrmteekfekvinanltgafrvaqrasrsmq
rnkfgrmifigsvsglwgignqanyaaskagvigmarsiarelskanvtanvvapgyidt
dmtralderiqqgalqfipakrvgtpaevagvvsflasedasyisgavipvdggmgmgh

SCOPe Domain Coordinates for d1uzna_:

Click to download the PDB-style file with coordinates for d1uzna_.
(The format of our PDB-style files is described here.)

Timeline for d1uzna_: