Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) C-terminal domain is beta/alpha barrel |
Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein) |
Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (13 species) |
Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [69730] (6 PDB entries) |
Domain d1uzho2: 1uzh O:7-149 [119801] Other proteins in same PDB: d1uzha1, d1uzhb1, d1uzhc1, d1uzhe1, d1uzhf_, d1uzhh1, d1uzhi_, d1uzhj_, d1uzhk1, d1uzhm_, d1uzho1, d1uzhp_, d1uzhr1, d1uzht_, d1uzhv1, d1uzhw_ automated match to d1gk8a2 complexed with cap, edo, mg |
PDB Entry: 1uzh (more details), 2.2 Å
SCOPe Domain Sequences for d1uzho2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uzho2 d.58.9.1 (O:7-149) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} tkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtw ttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfg fkalralrledlrippayvktfv
Timeline for d1uzho2: