Lineage for d1uzho1 (1uzh O:150-475)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2838499Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2838500Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
    N-terminal domain is alpha+beta
  6. 2838501Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (14 species)
  7. 2838525Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [69403] (6 PDB entries)
  8. 2838567Domain d1uzho1: 1uzh O:150-475 [119800]
    Other proteins in same PDB: d1uzha2, d1uzhb2, d1uzhc1, d1uzhe2, d1uzhf_, d1uzhh2, d1uzhi_, d1uzhj_, d1uzhk2, d1uzhm_, d1uzho2, d1uzhp_, d1uzhr2, d1uzht_, d1uzhv2, d1uzhw_
    automated match to d1gk8a1
    complexed with cap, edo, mg

Details for d1uzho1

PDB Entry: 1uzh (more details), 2.2 Å

PDB Description: a chimeric chlamydomonas, synechococcus rubisco enzyme
PDB Compounds: (O:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d1uzho1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uzho1 c.1.14.1 (O:150-475) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
gpphgiqverdklnkygrgllgctikpklglsaknygravyeclrggldftkddenvnsq
pfmrwrdrflfvaeaiykaqaetgevkghylnatagtceemmkravcakelgvpiimhdy
ltggftantslaiycrdnglllhihramhavidrqrnhgihfrvlakalrmsggdhlhsg
tvvgklegerevtlgfvdlmrddyvekdrsrgiyftqdwcsmpgvmpvasggihvwhmpa
lveifgddaclqfgggtlghpwgnapgaaanrvaleactqarnegrdlareggdvirsac
kwspelaaacevwkeikfefdtidkl

SCOPe Domain Coordinates for d1uzho1:

Click to download the PDB-style file with coordinates for d1uzho1.
(The format of our PDB-style files is described here.)

Timeline for d1uzho1: