| Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
| Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) ![]() C-terminal domain is beta/alpha barrel |
| Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein) |
| Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species) |
| Species Chlamydomonas reinhardtii [TaxId:3055] [69730] (6 PDB entries) |
| Domain d1uzhk2: 1uzh K:11-149 [119799] Other proteins in same PDB: d1uzha1, d1uzhb1, d1uzhe1, d1uzhh1, d1uzhk1, d1uzho1, d1uzhr1, d1uzhv1 automatically matched to d1gk8a2 complexed with cap, edo, mg |
PDB Entry: 1uzh (more details), 2.2 Å
SCOP Domain Sequences for d1uzhk2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uzhk2 d.58.9.1 (K:11-149) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlamydomonas reinhardtii [TaxId: 3055]}
agfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttvw
tdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfkal
ralrledlrippayvktfv
Timeline for d1uzhk2: