Lineage for d1uzhe2 (1uzh E:11-149)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 724752Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
    C-terminal domain is beta/alpha barrel
  5. 724753Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 724754Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)
  7. 724779Species Chlamydomonas reinhardtii [TaxId:3055] [69730] (6 PDB entries)
  8. 724826Domain d1uzhe2: 1uzh E:11-149 [119795]
    Other proteins in same PDB: d1uzha1, d1uzhb1, d1uzhe1, d1uzhh1, d1uzhk1, d1uzho1, d1uzhr1, d1uzhv1
    automatically matched to d1gk8a2
    complexed with cap, edo, mg

Details for d1uzhe2

PDB Entry: 1uzh (more details), 2.2 Å

PDB Description: a chimeric chlamydomonas, synechococcus rubisco enzyme
PDB Compounds: (E:) ribulose bisphosphate carboxylase large chain

SCOP Domain Sequences for d1uzhe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uzhe2 d.58.9.1 (E:11-149) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlamydomonas reinhardtii [TaxId: 3055]}
agfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttvw
tdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfkal
ralrledlrippayvktfv

SCOP Domain Coordinates for d1uzhe2:

Click to download the PDB-style file with coordinates for d1uzhe2.
(The format of our PDB-style files is described here.)

Timeline for d1uzhe2: