Lineage for d1uzhb2 (1uzh B:9-149)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2952777Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2952778Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 2952779Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (13 species)
  7. 2952803Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [69730] (6 PDB entries)
  8. 2952841Domain d1uzhb2: 1uzh B:9-149 [119793]
    Other proteins in same PDB: d1uzha1, d1uzhb1, d1uzhc1, d1uzhe1, d1uzhf_, d1uzhh1, d1uzhi_, d1uzhj_, d1uzhk1, d1uzhm_, d1uzho1, d1uzhp_, d1uzhr1, d1uzht_, d1uzhv1, d1uzhw_
    automated match to d1gk8a2
    complexed with cap, edo, mg

Details for d1uzhb2

PDB Entry: 1uzh (more details), 2.2 Å

PDB Description: a chimeric chlamydomonas, synechococcus rubisco enzyme
PDB Compounds: (B:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d1uzhb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uzhb2 d.58.9.1 (B:9-149) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
agagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwtt
vwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfk
alralrledlrippayvktfv

SCOPe Domain Coordinates for d1uzhb2:

Click to download the PDB-style file with coordinates for d1uzhb2.
(The format of our PDB-style files is described here.)

Timeline for d1uzhb2: