Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) C-terminal domain is beta/alpha barrel |
Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein) |
Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species) |
Species Chlamydomonas reinhardtii [TaxId:3055] [69730] (6 PDB entries) |
Domain d1uzdo2: 1uzd O:11-149 [119785] Other proteins in same PDB: d1uzda1, d1uzdb1, d1uzde1, d1uzdh1, d1uzdk1, d1uzdo1, d1uzdr1, d1uzdv1 automatically matched to d1gk8a2 complexed with cap, edo, mg |
PDB Entry: 1uzd (more details), 2.4 Å
SCOP Domain Sequences for d1uzdo2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uzdo2 d.58.9.1 (O:11-149) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlamydomonas reinhardtii [TaxId: 3055]} agfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttvw tdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfkal ralrledlrippayvktfv
Timeline for d1uzdo2: