Lineage for d1uzdh2 (1uzd H:7-149)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2952777Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2952778Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 2952779Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (13 species)
  7. 2952803Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [69730] (6 PDB entries)
  8. 2952851Domain d1uzdh2: 1uzd H:7-149 [119781]
    Other proteins in same PDB: d1uzda1, d1uzdb1, d1uzdc1, d1uzde1, d1uzdf_, d1uzdh1, d1uzdi_, d1uzdj_, d1uzdk1, d1uzdm_, d1uzdo1, d1uzdp_, d1uzdr1, d1uzdt_, d1uzdv1, d1uzdw_
    automated match to d1gk8a2
    complexed with cap, edo, mg

Details for d1uzdh2

PDB Entry: 1uzd (more details), 2.4 Å

PDB Description: chlamydomonas,spinach chimeric rubisco
PDB Compounds: (H:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d1uzdh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uzdh2 d.58.9.1 (H:7-149) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
tkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtw
ttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfg
fkalralrledlrippayvktfv

SCOPe Domain Coordinates for d1uzdh2:

Click to download the PDB-style file with coordinates for d1uzdh2.
(The format of our PDB-style files is described here.)

Timeline for d1uzdh2: