![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) ![]() C-terminal domain is beta/alpha barrel |
![]() | Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein) |
![]() | Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (13 species) |
![]() | Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [69730] (6 PDB entries) |
![]() | Domain d1uzde2: 1uzd E:11-149 [119779] Other proteins in same PDB: d1uzda1, d1uzdb1, d1uzdc1, d1uzde1, d1uzdf_, d1uzdh1, d1uzdi_, d1uzdj_, d1uzdk1, d1uzdm_, d1uzdo1, d1uzdp_, d1uzdr1, d1uzdt_, d1uzdv1, d1uzdw_ automated match to d1gk8a2 complexed with cap, edo, mg |
PDB Entry: 1uzd (more details), 2.4 Å
SCOPe Domain Sequences for d1uzde2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uzde2 d.58.9.1 (E:11-149) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} agfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttvw tdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfkal ralrledlrippayvktfv
Timeline for d1uzde2: