Lineage for d1uzdb2 (1uzd B:11-149)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 862528Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
    C-terminal domain is beta/alpha barrel
  5. 862529Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 862530Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)
  7. 862555Species Chlamydomonas reinhardtii [TaxId:3055] [69730] (11 PDB entries)
  8. 862633Domain d1uzdb2: 1uzd B:11-149 [119777]
    Other proteins in same PDB: d1uzda1, d1uzdb1, d1uzdc1, d1uzde1, d1uzdf1, d1uzdh1, d1uzdi1, d1uzdj1, d1uzdk1, d1uzdm1, d1uzdo1, d1uzdp1, d1uzdr1, d1uzdt1, d1uzdv1, d1uzdw1
    automatically matched to d1gk8a2
    complexed with cap, edo, mg

Details for d1uzdb2

PDB Entry: 1uzd (more details), 2.4 Å

PDB Description: chlamydomonas,spinach chimeric rubisco
PDB Compounds: (B:) ribulose bisphosphate carboxylase large chain

SCOP Domain Sequences for d1uzdb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uzdb2 d.58.9.1 (B:11-149) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlamydomonas reinhardtii [TaxId: 3055]}
agfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttvw
tdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfkal
ralrledlrippayvktfv

SCOP Domain Coordinates for d1uzdb2:

Click to download the PDB-style file with coordinates for d1uzdb2.
(The format of our PDB-style files is described here.)

Timeline for d1uzdb2: