Class a: All alpha proteins [46456] (284 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.1: Cytochrome P450 [48265] (23 proteins) |
Protein automated matches [190068] (8 species) not a true protein |
Species Pseudomonas putida [TaxId:303] [186787] (5 PDB entries) |
Domain d1uyub_: 1uyu B: [119771] automated match to d1t87a_ complexed with cam, hem, k, xe |
PDB Entry: 1uyu (more details), 2 Å
SCOPe Domain Sequences for d1uyub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uyub_ a.104.1.1 (B:) automated matches {Pseudomonas putida [TaxId: 303]} nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq lireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg ldtvvnflsfsmeflakspehrqeliqrperipaaceellrrfslvadgriltsdyefhg vqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiiv tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
Timeline for d1uyub_: