Lineage for d1uyub1 (1uyu B:11-414)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 646332Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 646333Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 646334Family a.104.1.1: Cytochrome P450 [48265] (21 proteins)
  6. 646437Protein Cytochrome P450-CAM [48266] (1 species)
  7. 646438Species Pseudomonas putida [TaxId:303] [48267] (57 PDB entries)
  8. 646482Domain d1uyub1: 1uyu B:11-414 [119771]
    automatically matched to d1akd__
    complexed with cam, hem, k, xe

Details for d1uyub1

PDB Entry: 1uyu (more details), 2 Å

PDB Description: xenon complex of wildtype p450cam from pseudomonas putida
PDB Compounds: (B:) Cytochrome P450-cam

SCOP Domain Sequences for d1uyub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uyub1 a.104.1.1 (B:11-414) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]}
laplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgql
ireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklenr
iqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdgs
mtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvggl
dtvvnflsfsmeflakspehrqeliqrperipaaceellrrfslvadgriltsdyefhgv
qlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiivt
lkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav

SCOP Domain Coordinates for d1uyub1:

Click to download the PDB-style file with coordinates for d1uyub1.
(The format of our PDB-style files is described here.)

Timeline for d1uyub1: