![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (1 family) ![]() |
![]() | Family a.104.1.1: Cytochrome P450 [48265] (21 proteins) |
![]() | Protein Cytochrome P450-CAM [48266] (1 species) |
![]() | Species Pseudomonas putida [TaxId:303] [48267] (57 PDB entries) |
![]() | Domain d1uyub1: 1uyu B:11-414 [119771] automatically matched to d1akd__ complexed with cam, hem, k, xe |
PDB Entry: 1uyu (more details), 2 Å
SCOP Domain Sequences for d1uyub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uyub1 a.104.1.1 (B:11-414) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} laplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgql ireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklenr iqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdgs mtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvggl dtvvnflsfsmeflakspehrqeliqrperipaaceellrrfslvadgriltsdyefhgv qlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiivt lkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
Timeline for d1uyub1: