Lineage for d1uyub_ (1uyu B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005432Protein automated matches [190068] (8 species)
    not a true protein
  7. 2005501Species Pseudomonas putida [TaxId:303] [186787] (6 PDB entries)
  8. 2005504Domain d1uyub_: 1uyu B: [119771]
    automated match to d1t87a_
    complexed with cam, hem, k, xe

Details for d1uyub_

PDB Entry: 1uyu (more details), 2 Å

PDB Description: xenon complex of wildtype p450cam from pseudomonas putida
PDB Compounds: (B:) Cytochrome P450-cam

SCOPe Domain Sequences for d1uyub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uyub_ a.104.1.1 (B:) automated matches {Pseudomonas putida [TaxId: 303]}
nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
lireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
ldtvvnflsfsmeflakspehrqeliqrperipaaceellrrfslvadgriltsdyefhg
vqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiiv
tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav

SCOPe Domain Coordinates for d1uyub_:

Click to download the PDB-style file with coordinates for d1uyub_.
(The format of our PDB-style files is described here.)

Timeline for d1uyub_: