![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.1: Cytochrome P450 [48265] (23 proteins) |
![]() | Protein automated matches [190068] (12 species) not a true protein |
![]() | Species Pseudomonas putida [TaxId:303] [186787] (6 PDB entries) |
![]() | Domain d1uyua_: 1uyu A: [119770] automated match to d1t87a_ complexed with cam, hem, k, xe |
PDB Entry: 1uyu (more details), 2 Å
SCOPe Domain Sequences for d1uyua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uyua_ a.104.1.1 (A:) automated matches {Pseudomonas putida [TaxId: 303]} laplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgql ireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklenr iqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdgs mtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvggl dtvvnflsfsmeflakspehrqeliqrperipaaceellrrfslvadgriltsdyefhgv qlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiivt lkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
Timeline for d1uyua_: