Lineage for d1uyqa1 (1uyq A:2-448)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2082913Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 protein domains)
  6. 2082923Protein Beta-glucosidase A [51528] (9 species)
  7. 2082941Species Bacillus polymyxa [TaxId:1406] [51529] (5 PDB entries)
  8. 2082942Domain d1uyqa1: 1uyq A:2-448 [119769]
    complexed with g2f, nfg

Details for d1uyqa1

PDB Entry: 1uyq (more details), 2.2 Å

PDB Description: mutated b-glucosidase a from paenibacillus polymyxa showing increased stability
PDB Compounds: (A:) beta-glucosidase a

SCOPe Domain Sequences for d1uyqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uyqa1 c.1.8.4 (A:2-448) Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406]}
tifqfpqdfmwgtataayqiegayqedgrglsiwdtfahtpgkvfngdngnvacdsyhry
eedirlmkelgirtyrfsvswprifpngdgevnqegldyyhrvvdllndngiepfctlyh
wdlpqalqdaggwgnrrtiqafvqfaetmfrefhgkiqhwltfnepwciaflsnmlgvha
pgltnlqtaidvghhllvahglsvrrfrelgtsgqigiapnvswavpystseedkaacar
tislhsdwflqpiyqgsypqflvdwfaeqgatvpiqdgdmdiigepidmiginyysmsvn
rfnpeagflqseeinmglpvtdigwpvesrglyevlhylqkygnidiyitengacindev
vngkvqddrrisymqqhlvqvhraihdglhvkgymawslldnfewaegynmrfgmihvdf
rtqvrtpkqsyywyrnvvgnnwletrr

SCOPe Domain Coordinates for d1uyqa1:

Click to download the PDB-style file with coordinates for d1uyqa1.
(The format of our PDB-style files is described here.)

Timeline for d1uyqa1: