SCOP 1.73: Domain d1uwxh1: 1uwx H:115-215

Lineage for d1uwxh1 (1uwx H:115-215)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)

8. Domain d1uwxh1: 1uwx H:115-215 [119767]
   Other proteins in same PDB: d1uwxa1, d1uwxb1
   automatically matched to d1igtb2

Details for d1uwxh1

PDB Entry: 1uwx, 2.2 Å

PDB Description: p1.2 serosubtype antigen derived from n. meningitidis pora in complex with fab fragment

PDB Compounds: (H:) antibody

SCOP Domain Sequences for d1uwxh1:

Sequence, based on SEQRES records:

>d1uwxh1 b.1.1.2 (H:115-215) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
kttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdl
ytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprgp

Sequence, based on observed residues (ATOM records):

>d1uwxh1 b.1.1.2 (H:115-215) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
kttapsvyplapvssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlsss
vtvtsstwpsqsitcnvahpasstkvdkkieprgp

Timeline for d1uwxh1:

• d1uwxh1 is new in SCOP 1.73
  
• d1uwxh1 appears in SCOP 1.75
  
• d1uwxh1 appears in the current release, SCOPe 2.08