SCOP 1.75: Domain d1uwxa1: 1uwx A:5-62

Lineage for d1uwxa1 (1uwx A:5-62)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family)

5. Family d.15.7.1: Immunoglobulin-binding domains [54359] (2 proteins)

6. Protein Immunoglobulin-binding protein G, different constituent domains [54360] (1 species)

7. Species Streptococcus sp., group G [TaxId:1306] [54361] (28 PDB entries)

8. Domain d1uwxa1: 1uwx A:5-62 [119765]
   Other proteins in same PDB: d1uwxh1, d1uwxm1
   automatically matched to d1qkza_

Details for d1uwxa1

PDB Entry: 1uwx, 2.2 Å

PDB Description: p1.2 serosubtype antigen derived from n. meningitidis pora in complex with fab fragment

PDB Compounds: (A:) protein g-prime

SCOP Domain Sequences for d1uwxa1:

Sequence; same for both SEQRES and ATOM records:

>d1uwxa1 d.15.7.1 (A:5-62) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G [TaxId: 1306]}
vttyklvingktlkgetttkavdaataekvfkqyandngvdgewtyddatktftvtek

Timeline for d1uwxa1:

• d1uwxa1 first appeared in SCOP 1.73
  
• d1uwxa1 is called d1uwxa_ in SCOPe 2.01
  
• d1uwxa1 appears in the current release, SCOPe 2.08, called d1uwxa_