SCOPe 2.06: Domain d1uwpx_: 1uwp X:

Lineage for d1uwpx_ (1uwp X:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.1: PYP-like [55786] (3 proteins)

6. Protein Photoactive yellow protein, PYP [55787] (1 species)

7. Species Methylophilus methylotrophus, strain w3a1 [TaxId:17] [55788] (68 PDB entries)
   Uniprot P16113

8. Domain d1uwpx_: 1uwp X: [119764]
   automated match to d1nwza_
   complexed with hc4, so4

Details for d1uwpx_

PDB Entry: 1uwp, 1.2 Å

PDB Description: initial events in the photocycle of photoactive yellow protein

PDB Compounds: (X:) Photoactive yellow protein

SCOPe Domain Sequences for d1uwpx_:

Sequence; same for both SEQRES and ATOM records:

>d1uwpx_ d.110.3.1 (X:) Photoactive yellow protein, PYP {Methylophilus methylotrophus, strain w3a1 [TaxId: 17]}
mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditgrdpkqvigk
nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
fvkrv

Timeline for d1uwpx_:

• d1uwpx_ first appeared in SCOP 1.73, called d1uwpx1
  
• d1uwpx_ appears in SCOPe 2.05
  
• d1uwpx_ appears in SCOPe 2.07
  
• d1uwpx_ appears in the current release, SCOPe 2.08