Lineage for d1uwfa1 (1uwf A:1-158)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 938438Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 938566Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 938571Family b.2.3.2: Pilus subunits [49405] (9 proteins)
  6. 938585Protein Mannose-specific adhesin FimH [49406] (1 species)
    duplication: consists of two domains of this fold; C-terminal domain lacks the last strand
  7. 938586Species Escherichia coli [TaxId:562] [49407] (7 PDB entries)
  8. 938587Domain d1uwfa1: 1uwf A:1-158 [119758]
    automatically matched to d1klfb1
    complexed with deg, gol

Details for d1uwfa1

PDB Entry: 1uwf (more details), 1.69 Å

PDB Description: 1.7 a resolution structure of the receptor binding domain of the fimh adhesin from uropathogenic e. coli
PDB Compounds: (A:) FimH PROTEIN

SCOPe Domain Sequences for d1uwfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uwfa1 b.2.3.2 (A:1-158) Mannose-specific adhesin FimH {Escherichia coli [TaxId: 562]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

SCOPe Domain Coordinates for d1uwfa1:

Click to download the PDB-style file with coordinates for d1uwfa1.
(The format of our PDB-style files is described here.)

Timeline for d1uwfa1: