Class b: All beta proteins [48724] (165 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.3: Bacterial adhesins [49401] (6 families) |
Family b.2.3.2: Pilus subunits [49405] (5 proteins) |
Protein Mannose-specific adhesin FimH [49406] (1 species) duplication: consists of two domains of this fold; C-terminal domain lacks the last strand |
Species Escherichia coli [TaxId:562] [49407] (6 PDB entries) |
Domain d1uwfa1: 1uwf A:1-158 [119758] automatically matched to d1klfb1 complexed with deg, gol |
PDB Entry: 1uwf (more details), 1.69 Å
SCOP Domain Sequences for d1uwfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uwfa1 b.2.3.2 (A:1-158) Mannose-specific adhesin FimH {Escherichia coli [TaxId: 562]} facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai kagsliavlilrqtnnynsddfqfvwniyanndvvvpt
Timeline for d1uwfa1: