SCOPe 2.08: Domain d1uwfa_: 1uwf A:

Lineage for d1uwfa_ (1uwf A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.2: Pilus subunits [49405] (11 proteins)

6. Protein Mannose-specific adhesin FimH, N-terminal domain [418900] (2 species)
   protein duplication: consists of two domains of this fold; C-terminal domain lacks the last strand

7. Species Escherichia coli [TaxId:562] [419300] (24 PDB entries)

8. Domain d1uwfa_: 1uwf A: [119758]
   automated match to d1uwfa1
   complexed with deg, gol

Details for d1uwfa_

PDB Entry: 1uwf, 1.69 Å

PDB Description: 1.7 a resolution structure of the receptor binding domain of the fimh adhesin from uropathogenic e. coli

PDB Compounds: (A:) FimH PROTEIN

SCOPe Domain Sequences for d1uwfa_:

Sequence; same for both SEQRES and ATOM records:

>d1uwfa_ b.2.3.2 (A:) Mannose-specific adhesin FimH, N-terminal domain {Escherichia coli [TaxId: 562]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

Timeline for d1uwfa_:

• d1uwfa_ first appeared in SCOP 1.73, called d1uwfa1
  
• d1uwfa_ appears in SCOPe 2.07