Lineage for d1uwao2 (1uwa O:7-149)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1909192Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 1909384Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 1909385Protein automated matches [226983] (12 species)
    not a true protein
  7. 1909408Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [225547] (9 PDB entries)
  8. 1909462Domain d1uwao2: 1uwa O:7-149 [119750]
    Other proteins in same PDB: d1uwaa1, d1uwab1, d1uwac_, d1uwae1, d1uwaf_, d1uwah1, d1uwai_, d1uwaj_, d1uwak1, d1uwam_, d1uwao1, d1uwap_, d1uwar1, d1uwat_, d1uwav1, d1uwaw_
    automated match to d1gk8a2
    complexed with cap, edo, mg; mutant

Details for d1uwao2

PDB Entry: 1uwa (more details), 2.3 Å

PDB Description: l290f mutant rubisco from chlamydomonas
PDB Compounds: (O:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d1uwao2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uwao2 d.58.9.0 (O:7-149) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
tkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtw
ttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfg
fkalralrledlrippayvktfv

SCOPe Domain Coordinates for d1uwao2:

Click to download the PDB-style file with coordinates for d1uwao2.
(The format of our PDB-style files is described here.)

Timeline for d1uwao2: