| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) ![]() |
| Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins) |
| Protein automated matches [190066] (5 species) not a true protein |
| Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [186785] (7 PDB entries) |
| Domain d1uw9w_: 1uw9 W: [119733] Other proteins in same PDB: d1uw9a1, d1uw9a2, d1uw9b1, d1uw9b2, d1uw9e1, d1uw9e2, d1uw9h1, d1uw9h2, d1uw9k1, d1uw9k2, d1uw9o1, d1uw9o2, d1uw9r1, d1uw9r2, d1uw9v1, d1uw9v2 automated match to d1ir21_ complexed with cap, edo, mg; mutant |
PDB Entry: 1uw9 (more details), 2.05 Å
SCOPe Domain Sequences for d1uw9w_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uw9w_ d.73.1.1 (W:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
flvqrpksardwqpankrsv
Timeline for d1uw9w_: