Lineage for d1uw9o1 (1uw9 O:150-475)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2447081Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2447082Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
    N-terminal domain is alpha+beta
  6. 2447312Protein automated matches [226984] (16 species)
    not a true protein
  7. 2447326Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [225548] (9 PDB entries)
  8. 2447340Domain d1uw9o1: 1uw9 O:150-475 [119725]
    Other proteins in same PDB: d1uw9a2, d1uw9b2, d1uw9c_, d1uw9e2, d1uw9f_, d1uw9h2, d1uw9i_, d1uw9j_, d1uw9k2, d1uw9m_, d1uw9o2, d1uw9p_, d1uw9r2, d1uw9t_, d1uw9v2, d1uw9w_
    automated match to d1gk8a1
    complexed with cap, edo, mg; mutant

Details for d1uw9o1

PDB Entry: 1uw9 (more details), 2.05 Å

PDB Description: l290f-a222t chlamydomonas rubisco mutant
PDB Compounds: (O:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d1uw9o1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uw9o1 c.1.14.1 (O:150-475) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
gpphgiqverdklnkygrgllgctikpklglsaknygravyeclrggldftkddenvnsq
pfmrwrdrflfvteaiykaqaetgevkghylnatagtceemmkravcakelgvpiimhdy
ltggftantslaiycrdnglflhihramhavidrqrnhgihfrvlakalrmsggdhlhsg
tvvgklegerevtlgfvdlmrddyvekdrsrgiyftqdwcsmpgvmpvasggihvwhmpa
lveifgddaclqfgggtlghpwgnapgaaanrvaleactqarnegrdlareggdvirsac
kwspelaaacevwkeikfefdtidkl

SCOPe Domain Coordinates for d1uw9o1:

Click to download the PDB-style file with coordinates for d1uw9o1.
(The format of our PDB-style files is described here.)

Timeline for d1uw9o1: