Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) automatically mapped to Pfam PF00016 |
Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins) N-terminal domain is alpha+beta |
Protein automated matches [226984] (16 species) not a true protein |
Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [225548] (9 PDB entries) |
Domain d1uw9h1: 1uw9 H:150-475 [119718] Other proteins in same PDB: d1uw9a2, d1uw9b2, d1uw9c_, d1uw9e2, d1uw9f_, d1uw9h2, d1uw9i_, d1uw9j_, d1uw9k2, d1uw9m_, d1uw9o2, d1uw9p_, d1uw9r2, d1uw9t_, d1uw9v2, d1uw9w_ automated match to d1gk8a1 complexed with cap, edo, mg; mutant |
PDB Entry: 1uw9 (more details), 2.05 Å
SCOPe Domain Sequences for d1uw9h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uw9h1 c.1.14.1 (H:150-475) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} gpphgiqverdklnkygrgllgctikpklglsaknygravyeclrggldftkddenvnsq pfmrwrdrflfvteaiykaqaetgevkghylnatagtceemmkravcakelgvpiimhdy ltggftantslaiycrdnglflhihramhavidrqrnhgihfrvlakalrmsggdhlhsg tvvgklegerevtlgfvdlmrddyvekdrsrgiyftqdwcsmpgvmpvasggihvwhmpa lveifgddaclqfgggtlghpwgnapgaaanrvaleactqarnegrdlareggdvirsac kwspelaaacevwkeikfefdtidkl
Timeline for d1uw9h1: