SCOPe 2.08: Domain d1uw9e2: 1uw9 E:11-149

Lineage for d1uw9e2 (1uw9 E:11-149)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.0: automated matches [227234] (1 protein)
   not a true family

6. Protein automated matches [226983] (27 species)
   not a true protein

7. Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [225547] (9 PDB entries)

8. Domain d1uw9e2: 1uw9 E:11-149 [119716]
   Other proteins in same PDB: d1uw9a1, d1uw9b1, d1uw9c_, d1uw9e1, d1uw9f_, d1uw9h1, d1uw9i_, d1uw9j_, d1uw9k1, d1uw9m_, d1uw9o1, d1uw9p_, d1uw9r1, d1uw9t_, d1uw9v1, d1uw9w_
   automated match to d1gk8a2
   complexed with cap, edo, mg; mutant

Details for d1uw9e2

PDB Entry: 1uw9, 2.05 Å

PDB Description: l290f-a222t chlamydomonas rubisco mutant

PDB Compounds: (E:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d1uw9e2:

Sequence; same for both SEQRES and ATOM records:

>d1uw9e2 d.58.9.0 (E:11-149) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
agfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttvw
tdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfkal
ralrledlrippayvktfv

Timeline for d1uw9e2:

• d1uw9e2 first appeared in SCOP 1.73
  
• d1uw9e2 appears in SCOPe 2.07