Lineage for d1uw9c_ (1uw9 C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1913207Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 1913208Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 1913209Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 1913367Protein automated matches [190066] (5 species)
    not a true protein
  7. 1913368Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [186785] (7 PDB entries)
  8. 1913385Domain d1uw9c_: 1uw9 C: [119714]
    Other proteins in same PDB: d1uw9a1, d1uw9a2, d1uw9b1, d1uw9b2, d1uw9e1, d1uw9e2, d1uw9h1, d1uw9h2, d1uw9k1, d1uw9k2, d1uw9o1, d1uw9o2, d1uw9r1, d1uw9r2, d1uw9v1, d1uw9v2
    automated match to d1ir21_
    complexed with cap, edo, mg; mutant

Details for d1uw9c_

PDB Entry: 1uw9 (more details), 2.05 Å

PDB Description: l290f-a222t chlamydomonas rubisco mutant
PDB Compounds: (C:) ribulose bisphosphate carboxylase small chain 1

SCOPe Domain Sequences for d1uw9c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uw9c_ d.73.1.1 (C:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
flvqrpksardwqpankrsv

SCOPe Domain Coordinates for d1uw9c_:

Click to download the PDB-style file with coordinates for d1uw9c_.
(The format of our PDB-style files is described here.)

Timeline for d1uw9c_: