![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (10 proteins) |
![]() | Protein automated matches [190041] (27 species) not a true protein |
![]() | Species Mycobacterium smegmatis [TaxId:1772] [186784] (1 PDB entry) |
![]() | Domain d1uvhc_: 1uvh C: [119708] automated match to d1veia_ complexed with fe |
PDB Entry: 1uvh (more details), 2.8 Å
SCOPe Domain Sequences for d1uvhc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uvhc_ a.25.1.1 (C:) automated matches {Mycobacterium smegmatis [TaxId: 1772]} tipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvrgy adevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrksi ekledldlvsqdlliahagelekfqwfvrahlesagg
Timeline for d1uvhc_: