Lineage for d1uvhc_ (1uvh C:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1727563Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1727564Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1727565Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1728504Protein automated matches [190041] (24 species)
    not a true protein
  7. 1728849Species Mycobacterium smegmatis [TaxId:1772] [186784] (1 PDB entry)
  8. 1728852Domain d1uvhc_: 1uvh C: [119708]
    automated match to d1veia_
    complexed with fe

Details for d1uvhc_

PDB Entry: 1uvh (more details), 2.8 Å

PDB Description: x-ray structure of dps from mycobacterium smegmatis
PDB Compounds: (C:) starvation-induced DNA protecting protein

SCOPe Domain Sequences for d1uvhc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uvhc_ a.25.1.1 (C:) automated matches {Mycobacterium smegmatis [TaxId: 1772]}
tipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvrgy
adevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrksi
ekledldlvsqdlliahagelekfqwfvrahlesagg

SCOPe Domain Coordinates for d1uvhc_:

Click to download the PDB-style file with coordinates for d1uvhc_.
(The format of our PDB-style files is described here.)

Timeline for d1uvhc_: