Lineage for d1uvhb1 (1uvh B:5-161)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 638518Fold a.25: Ferritin-like [47239] (4 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 638519Superfamily a.25.1: Ferritin-like [47240] (5 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 638520Family a.25.1.1: Ferritin [47241] (9 proteins)
  6. 638728Protein Dodecameric ferritin homolog [47250] (13 species)
  7. 638955Species Mycobacterium smegmatis [TaxId:1772] [109784] (4 PDB entries)
  8. 638964Domain d1uvhb1: 1uvh B:5-161 [119707]
    automatically matched to d1veia_
    complexed with fe

Details for d1uvhb1

PDB Entry: 1uvh (more details), 2.8 Å

PDB Description: x-ray structure of dps from mycobacterium smegmatis
PDB Compounds: (B:) starvation-induced DNA protecting protein

SCOP Domain Sequences for d1uvhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uvhb1 a.25.1.1 (B:5-161) Dodecameric ferritin homolog {Mycobacterium smegmatis [TaxId: 1772]}
tipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvrgy
adevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrksi
ekledldlvsqdlliahagelekfqwfvrahlesagg

SCOP Domain Coordinates for d1uvhb1:

Click to download the PDB-style file with coordinates for d1uvhb1.
(The format of our PDB-style files is described here.)

Timeline for d1uvhb1: