Class a: All alpha proteins [46456] (258 folds) |
Fold a.25: Ferritin-like [47239] (4 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (5 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (9 proteins) |
Protein Dodecameric ferritin homolog [47250] (13 species) |
Species Mycobacterium smegmatis [TaxId:1772] [109784] (4 PDB entries) |
Domain d1uvha1: 1uvh A:5-161 [119706] automatically matched to d1veia_ complexed with fe |
PDB Entry: 1uvh (more details), 2.8 Å
SCOP Domain Sequences for d1uvha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uvha1 a.25.1.1 (A:5-161) Dodecameric ferritin homolog {Mycobacterium smegmatis [TaxId: 1772]} tipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvrgy adevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrksi ekledldlvsqdlliahagelekfqwfvrahlesagg
Timeline for d1uvha1: