SCOPe 2.08: Domain d1uvha_: 1uvh A:

Lineage for d1uvha_ (1uvh A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein automated matches [190041] (34 species)
   not a true protein

7. Species Mycobacterium smegmatis [TaxId:1772] [186784] (1 PDB entry)

8. Domain d1uvha_: 1uvh A: [119706]
   automated match to d1veia_
   complexed with fe

Details for d1uvha_

PDB Entry: 1uvh, 2.8 Å

PDB Description: x-ray structure of dps from mycobacterium smegmatis

PDB Compounds: (A:) starvation-induced DNA protecting protein

SCOPe Domain Sequences for d1uvha_:

Sequence; same for both SEQRES and ATOM records:

>d1uvha_ a.25.1.1 (A:) automated matches {Mycobacterium smegmatis [TaxId: 1772]}
tipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvrgy
adevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrksi
ekledldlvsqdlliahagelekfqwfvrahlesagg

Timeline for d1uvha_:

• d1uvha_ first appeared in SCOP 1.73, called d1uvha1
  
• d1uvha_ appears in SCOPe 2.07