Lineage for d1uv4a1 (1uv4 A:3-293)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2807321Fold b.67: 5-bladed beta-propeller [50933] (4 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 2807331Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) (S)
  5. 2807332Family b.67.2.1: alpha-L-arabinanase-like [75006] (5 proteins)
    automatically mapped to Pfam PF04616
  6. 2807381Protein Endo-1,5-arabinanase [141536] (1 species)
  7. 2807382Species Bacillus subtilis [TaxId:1423] [141537] (1 PDB entry)
    Uniprot Q5MPF4 33-323
  8. 2807383Domain d1uv4a1: 1uv4 A:3-293 [119705]
    complexed with ca, edo

Details for d1uv4a1

PDB Entry: 1uv4 (more details), 1.5 Å

PDB Description: native bacillus subtilis arabinanase arb43a
PDB Compounds: (A:) arabinan-endo 1,5-alpha-l-arabinase

SCOPe Domain Sequences for d1uv4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uv4a1 b.67.2.1 (A:3-293) Endo-1,5-arabinanase {Bacillus subtilis [TaxId: 1423]}
afwgasnellhdptmikegsswyalgtglteerglrvlkssdaknwtvqksifttplsww
snyvpnygqnqwapdiqyyngkywlyysvssfgsntsaiglasstsissggwkdeglvir
stssnnynaidpeltfdkdgnpwlafgsfwsgikltkldkstmkptgslysiaarpnngg
aleaptltyqngyyylmvsfdkccdgvnstykiaygrsksitgpyldksgksmlegggti
ldsgndqwkgpggqdivngnilvrhaydandngipkllindlnwssgwpsy

SCOPe Domain Coordinates for d1uv4a1:

Click to download the PDB-style file with coordinates for d1uv4a1.
(The format of our PDB-style files is described here.)

Timeline for d1uv4a1: