![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.67: 5-bladed beta-propeller [50933] (4 superfamilies) consists of five 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) ![]() |
![]() | Family b.67.2.1: alpha-L-arabinanase-like [75006] (5 proteins) automatically mapped to Pfam PF04616 |
![]() | Protein Endo-1,5-arabinanase [141536] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [141537] (1 PDB entry) Uniprot Q5MPF4 33-323 |
![]() | Domain d1uv4a1: 1uv4 A:3-293 [119705] complexed with ca, edo |
PDB Entry: 1uv4 (more details), 1.5 Å
SCOPe Domain Sequences for d1uv4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uv4a1 b.67.2.1 (A:3-293) Endo-1,5-arabinanase {Bacillus subtilis [TaxId: 1423]} afwgasnellhdptmikegsswyalgtglteerglrvlkssdaknwtvqksifttplsww snyvpnygqnqwapdiqyyngkywlyysvssfgsntsaiglasstsissggwkdeglvir stssnnynaidpeltfdkdgnpwlafgsfwsgikltkldkstmkptgslysiaarpnngg aleaptltyqngyyylmvsfdkccdgvnstykiaygrsksitgpyldksgksmlegggti ldsgndqwkgpggqdivngnilvrhaydandngipkllindlnwssgwpsy
Timeline for d1uv4a1: